SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0WKT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WKT6
Domain Number 1 Region: 51-528
Classification Level Classification E-value
Superfamily ALDH-like 6.94e-133
Family ALDH-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WKT6
Sequence length 540
Comment (tr|H0WKT6|H0WKT6_OTOGA) Aldehyde dehydrogenase 7 family member A1 {ECO:0000313|Ensembl:ENSOGAP00000002214} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ALDH7A1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MWRLPRAVCVHAAKTSKLSAPWNRPVAFMSSLLINQPQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWQVWADIPAPKRGEIVRQIGDA
LRDKIQILGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPAHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIGFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDANVLYGPLHTRQAVDMFLGAVEKAKKEGGTVVYGGKKVMDRPGNYVEPTIVTGLAH
DASIVHTETFAPILYVFKFKNEDEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCG
IVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMKRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences H0WKT6
ENSOGAP00000002214 ENSOGAP00000002214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]