SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0WMS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WMS5
Domain Number 1 Region: 17-286
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.75e-82
Family Carbonic anhydrase 0.0000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0WMS5
Sequence length 314
Comment (tr|H0WMS5|H0WMS5_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000003066} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=CA4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MWRLLALLVFAAARTSAAAESHWCYEIQAEAPNQLCLGPSNWTGSCQKNRQSPIDIVTSK
AKEDQTLGHFIFSGYDKKEKRNVSNNGHSVEVTLKNDNIEISGGGLPTGYQATQLHLHWS
SEMNAGSEHSIDGKRFAMEMHIVHNKKVTGTSKSAKEAQNTGDDIAVLAFLVKEGPKENE
GFWPLVEALAHIPKPGMDTEMREFSLWDMLPKEEKLRHYFRYQGSLTTPNCDETVVWTVF
QESIELRRDQILVFSQKLWYDAEQRVNMTDNVRPVQRLGDRTVFKSQAPGQLLPLPLPTL
LVPTLTYLAAGFLR
Download sequence
Identical sequences H0WMS5
ENSOGAP00000003066 ENSOGAP00000003066 XP_003795652.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]