SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0WPU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WPU7
Domain Number 1 Region: 412-901
Classification Level Classification E-value
Superfamily ALDH-like 8.9e-167
Family ALDH-like 0.000000000739
Further Details:      
 
Domain Number 2 Region: 1-200
Classification Level Classification E-value
Superfamily Formyltransferase 1.31e-50
Family Formyltransferase 0.00000000339
Further Details:      
 
Domain Number 3 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.38e-25
Family Post formyltransferase domain 0.0000013
Further Details:      
 
Domain Number 4 Region: 324-409
Classification Level Classification E-value
Superfamily ACP-like 0.00000131
Family Acyl-carrier protein (ACP) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WPU7
Sequence length 902
Comment (tr|H0WPU7|H0WPU7_OTOGA) 10-formyltetrahydrofolate dehydrogenase {ECO:0000256|PIRNR:PIRNR036489} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ALDH1L1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKFPRWR
AQGQALPDVVAKYKALGAELNVLPFCSQFIPMEIISAPQHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQQECEVLPDDTVSSLYNRFLFPEGIKGMVQAV
RLIAEGKAPRVPQPKEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTSGVAPEGEALSIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMI
LASNFFKGADSSALELMEEELATAEAVRSIWQRILPNVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGDNEESECAINYVEMAVNKRTLQI
PHQLFIGGAFVDAEGGKTFETINPTDGSVICQVSLAQVSDVDKAVAAAKDAFENGLWGKI
SARDRGKLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNILPGSGSQAGQSLLDHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLIIFADCDLNKAVTMGMSSVFFNKGENCIAAGRLFVEDSIH
DEFVQRVVEEVKKMKIGNPLDRDTTHGPQNHQAHLTKLLQYCQRGVKEGATLVCGGNQVS
RPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALDEYLRVKTVTF
EY
Download sequence
Identical sequences H0WPU7
XP_003796227.1.62490 XP_012664694.1.62490 ENSOGAP00000003942 ENSOGAP00000003942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]