SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0X2N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X2N1
Domain Number 1 Region: 121-176
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.085
Further Details:      
 
Domain Number 2 Region: 37-79
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000916
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0X2N1
Sequence length 693
Comment (tr|H0X2N1|H0X2N1_OTOGA) Aryl-hydrocarbon receptor repressor {ECO:0000313|Ensembl:ENSOGAP00000009326} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=AHRR OC=Lorisiformes; Galagidae; Otolemur.
Sequence
PRTMIPPGECTYAGRKRRKPLQKQRPIRGAEKSNPSKRHRDRLNAELDHLASLLPFPPDI
ISKLDKLSVLRLSVSYLRVKSFFQVVQEKCPRRAASAPSVGDGCASGGSTVLEGRLLLES
LDGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFSRQLHWAMDPP
RASCGQPLPSDAGEDAVLGRLLRAQEGAAGSPAEFAAFLTRCFVCRVRCLLDSTSGFLAM
QFQGKLKFLFGQKKKAPSGTALPPRLSLFCVVVPLLLPPLAERKIKSACLRAKHRAEAMD
PKVKATMSLCESELHGKPNYLTGRSCEENSMLVFRAQTDASRWAQVPARAPCLCLGGGPN
LILDPRGAGGNREDGEQERSRSSSVVRGLRETHTLHSHCQLPGPTRCLDWVVGKHGKGIE
LKLQASKSDLLPMHPAPHGSCLSYPSVRGTFHAGGTATFRSLPIPQPPSQPLSTCSSRVS
RPLLDIREGQELPLNRHYPQGSIEKQLPQPGAQCFPVGGCSTAAAHLQSVQVTPDGLCHP
TFSLDTPIKMENDSEDTADGYTPSQAWLGTSDVAKSHLATFPTRMHLKTEPDSRCLVYTP
HLGPRRTPAGASGGVVPFYPTCCACLEHMHDLPQQGPPCHHSVLGRSAHQIPAWGSTCKA
TGATLVVKREPLDSPQWATQSQGAVPRVFLKGA
Download sequence
Identical sequences H0X2N1
ENSOGAP00000009326 ENSOGAP00000009326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]