SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0X9Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X9Z0
Domain Number 1 Region: 32-157
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.06e-23
Family Antibiotic resistance proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0X9Z0
Sequence length 160
Comment (tr|H0X9Z0|H0X9Z0_OTOGA) Glyoxalase domain containing 5 {ECO:0000313|Ensembl:ENSOGAP00000012412} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=GLOD5 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MLCLLSSSLLVRMWGRTSEKQSWRYNNHTPSPCVIHRLDHIVMTVKNIKDTTMFYSKILG
MEVTIFKEGRKALCFGDQKFNLHEVGNEFEPKAAHPVPGSLDICLITEVPLEKMIQHLKA
CDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYISS
Download sequence
Identical sequences H0X9Z0
ENSOGAP00000012412 ENSOGAP00000012412 XP_003799695.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]