SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0XH76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XH76
Domain Number 1 Region: 11-278
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.86e-92
Family TK-like PP module 0.0000926
Further Details:      
 
Domain Number 2 Region: 300-484
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.5e-54
Family TK-like Pyr module 0.0042
Further Details:      
 
Domain Number 3 Region: 491-624
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.54e-31
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XH76
Sequence length 626
Comment (tr|H0XH76|H0XH76_OTOGA) Transketolase like 2 {ECO:0000313|Ensembl:ENSOGAP00000015466} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TKTL2 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
AMADDAKPDAKTLQALRDAANRLRIHSIRATCASSSGHPTSCCSAAEIMSVLFFHTMRYK
RTDPQHPDNDRFVLSKGHAAPVLYAAWAEVGDISESDLLNLRKIHCDLEGHPTPRLPFVD
VATGSLGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWEALAFASHYSLDNLV
AVFDVNRLGQSGTAPLEHCTDIYQNRCEAFGWNTYIVDGHDVEALCQAFSQAAQVKNKPT
AIVAKTFKGRGIPNIEDAENWHGKPVPKERAEAIIKLIQSQIQTQGNPISKPPVEDSPQI
SITNIQMTSPPAYKMGDKIATQKAYGLALAKLGHENKRVIVLDSDTKNPTFSEIFKKEHP
ERFIECFIPEQNMVSVALGCATRGRTIVFANTFSAFFTRAFDQIRMGAISQTNINLIGSH
CGVSIGEDGPSQMALEDLAMFRSIPNCTVFYPSDALSTEHAVYLAANTKGMCFIRTSQPE
TEVIYTAQEKFEIGQAKVVLHSDNDKVTVIGAGITLHEALAAADNLSQQGIAIRVIDPFT
IKPLDAATIISSAKATGGRVITVEDHHKEGGLGEAVCAAVSREPDILVHQLAVSGLPQSG
KPGELLDMFGISAGHIVSAVRNILMN
Download sequence
Identical sequences H0XH76
ENSOGAP00000015466 ENSOGAP00000015466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]