SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0XHC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XHC8
Domain Number 1 Region: 92-263,296-305,377-409
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.79e-19
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 2 Region: 8-100
Classification Level Classification E-value
Superfamily F-box domain 1.44e-18
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XHC8
Sequence length 464
Comment (tr|H0XHC8|H0XHC8_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000015518} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=LOC100946480 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MAPQLGPHELLHVFSFLEARDLLSTAQVNKVWNEVSRTKELWRQLCLRRWSSCKASQMVP
GTQTWKQYYFCRSELEFRMASGRPEDFICKAIAGHKGWINELAYVSTNECRFDGRKKSVV
CTVSSDGTVRAWDLNEGTQIWSSPLQPDIMENLVTYPQLQLVVTIDSRGLIKAWKADNGW
EWASFRLPKSPSALEACDHPEGPFLLAACQGGNLYTLTVPQLHLVSKVPVFPNNPVSLNC
SPDQQWVFASTENLHLGPKVFYIPSLLYPSEDKPPVSTTLPAYLISRGCWAPEEAARLIV
VHGNDNGTEVIVTTFELGAKKSRDRVDVLVRQVASFLLPMIPHLIKGLGSEAILLASDSK
LVQFTIYGLQLAAFQDHEKHITSLWVDSSRVITSSFDLSLRVYVWNKENKYPILKSCYHL
LGGSHRWASGFTHVESDSMSIVGVETRNDGTGILRSYCFRVQHS
Download sequence
Identical sequences H0XHC8
ENSOGAP00000015518 ENSOGAP00000015518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]