SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0XIY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XIY7
Domain Number 1 Region: 10-322
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.67e-59
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XIY7
Sequence length 328
Comment (tr|H0XIY7|H0XIY7_OTOGA) MTOR associated protein, LST8 homolog {ECO:0000313|Ensembl:ENSOGAP00000016077} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=MLST8 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSTKQVNALEITPDRSMIA
AAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRN
LQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHI
DPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATC
SADQTCKIWRTSNFSLMTELSIRSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWC
VETGEIKREYGGHQKAVVCLAFNDSVLG
Download sequence
Identical sequences H0XIY7
ENSOGAP00000016077 ENSOGAP00000016077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]