SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0XMN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XMN8
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 6.15e-21
Family Ribosomal protein L39e 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XMN8
Sequence length 51
Comment (tr|H0XMN8|H0XMN8_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000017379} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN= OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MSSNKTFRIKRFLAKKQKQNRPVPQWIQMKTGNKIWYNSKRRHWRRTKLGL
Download sequence
Identical sequences H0XMN8
ENSOGAP00000017379 ENSOGAP00000017379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]