SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0Y4T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0Y4T0
Domain Number - Region: 11-71
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.000576
Family mRNA capping enzyme 0.088
Further Details:      
 
Domain Number - Region: 106-138
Classification Level Classification E-value
Superfamily WW domain 0.00381
Family WW domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Y4T0
Sequence length 156
Comment (tr|H0Y4T0|H0Y4T0_HUMAN) Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 {ECO:0000313|Ensembl:ENSP00000393893} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CMTR1 OC=Catarrhini; Hominidae; Homo.
Sequence
XGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVY
RLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFK
KKFFYNKKTKDSTFDLPADSIAPFHLPSLACLSKMD
Download sequence
Identical sequences H0Y4T0
ENSP00000393893 ENSP00000393893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]