SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0Y783 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y783
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-22
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0Y783
Sequence length 215
Comment (tr|H0Y783|H0Y783_HUMAN) FERM, ARHGEF and pleckstrin domain-containing protein 1 {ECO:0000313|Ensembl:ENSP00000410930} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FARP1 OC=Catarrhini; Hominidae; Homo.
Sequence
HLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQV
LERLCKHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVV
PGRVSSSGLTMHCAGSRKEASEGLTFEPFEERPLQSKMSSFHPPGRQLEKHNSVVSSESL
CSEEIKQSSDLIFCFFSLRGDSLLYLFPYHIPQKI
Download sequence
Identical sequences H0Y783
ENSP00000410930 ENSP00000410930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]