SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0Y9N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y9N3
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.45e-21
Family GABA-aminotransferase-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0Y9N3
Sequence length 115
Comment (tr|H0Y9N3|H0Y9N3_HUMAN) 5-phosphohydroxy-L-lysine phospho-lyase {ECO:0000313|Ensembl:ENSP00000424608} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PHYKPL OC=Catarrhini; Hominidae; Homo.
Sequence
QAAHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRLARHYT
GHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKEWVHVVCTAQLNNSDMLSSLG
Download sequence
Identical sequences A0A2J8JTV5 H0Y9N3
ENSP00000424608 ENSP00000424608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]