SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0YDL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YDL4
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-17
Family Phosphate binding protein-like 0.00000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YDL4
Sequence length 104
Comment (tr|H0YDL4|H0YDL4_HUMAN) Glutamate receptor 4 {ECO:0000313|Ensembl:ENSP00000433873} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GRIA4 OC=Catarrhini; Hominidae; Homo.
Sequence
XVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKNSCKPCRFETQ
Download sequence
Identical sequences H0YDL4
ENSP00000433873 ENSP00000433873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]