SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0YER9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YER9
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.77e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YER9
Sequence length 171
Comment (tr|H0YER9|H0YER9_HUMAN) Aryl hydrocarbon receptor nuclear translocator-like protein 1 {ECO:0000313|Ensembl:ENSP00000436442} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARNTL OC=Catarrhini; Hominidae; Homo.
Sequence
RATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFIT
LRSRWFSFMNPWTKEVEYIVSTNTVVLSRVDTGHLGQVEWCTVLSRPDSRFLIAGMFTEP
TSWKAGTQPSHSSQHPPTAWTACCPLEKVAQRGPTPLFQGFQGEPGLGQEK
Download sequence
Identical sequences H0YER9
ENSP00000436442 ENSP00000436442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]