SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0YGX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YGX7
Domain Number 1 Region: 7-194
Classification Level Classification E-value
Superfamily E set domains 5.32e-76
Family RhoGDI-like 0.0000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YGX7
Sequence length 195
Comment (tr|H0YGX7|H0YGX7_HUMAN) Rho GDP-dissociation inhibitor 2 {ECO:0000313|Ensembl:ENSP00000445185} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGDIB OC=Catarrhini; Hominidae; Homo.
Sequence
XEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAP
NVVVTRLTLVCESAPGPITMDLTDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYV
QHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDH
LSWEWNLSIKKEWTE
Download sequence
Identical sequences H0YGX7
ENSP00000445185 ENSP00000445185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]