SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0YLU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YLU3
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-84
Family alpha-mannosidase, C-terminal domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YLU3
Sequence length 319
Comment (tr|H0YLU3|H0YLU3_HUMAN) Alpha-mannosidase 2x {ECO:0000313|Ensembl:ENSP00000453341} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MAN2A2 OC=Catarrhini; Hominidae; Homo.
Sequence
XKEPPVLRVTEGPFFSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELAL
HIHTDIDSQGIFFTDLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQAL
GVSSLKDGQLEVILDRRLMQDDNRGLGQGLKDNKRTCNRFRLLLERRTVGSEPDFFSKLA
AMFRGLIFHSSRSGNREVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGPGLRSF
HPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNCTTSQGKV
ALGSLFHGLDVVFLQPTSL
Download sequence
Identical sequences H0YLU3
ENSP00000453341 ENSP00000453341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]