SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0YNQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YNQ3
Domain Number 1 Region: 26-118
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-20
Family ALDH-like 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YNQ3
Sequence length 141
Comment (tr|H0YNQ3|H0YNQ3_HUMAN) Aldehyde dehydrogenase family 1 member A3 {ECO:0000313|Ensembl:ENSP00000454107} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALDH1A3 OC=Catarrhini; Hominidae; Homo.
Sequence
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAMTTSC
ASPGMSPLVSVGPSLHGTSPC
Download sequence
Identical sequences H0YNQ3
ENSP00000454107 ENSP00000454107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]