SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0ZJF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZJF0
Domain Number 1 Region: 684-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.46e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1012-1107
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-30
Family Ras-binding domain, RBD 0.0009
Further Details:      
 
Domain Number 3 Region: 226-359
Classification Level Classification E-value
Superfamily PH domain-like 5.33e-22
Family Phosphotyrosine-binding domain (PTB) 0.024
Further Details:      
 
Domain Number 4 Region: 8-101
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-20
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000982
Family Ras-binding domain, RBD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZJF0
Sequence length 1357
Comment (tr|H0ZJF0|H0ZJF0_TAEGU) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSTGUP00000010718} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=RGS12 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MYRPGETVKRRLNTHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHMDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPALCAGNSDNSAPKQRSFSVSAAMKFE
TGNESVSNPNLLSKEEIAKVLNDDSVFRTGLESAEDFGLDASILNVAMIVGYLGSIELPS
TTANLETESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGTPPSKHIPSSIWENPVGRGQNQPASHWNGFCHEHEGNI
PLEVIQNDKSQNVSKHLSPSARIEVPLVSSRNSVPPSKKNAAGLGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVDGSFGQPQLKSHKSEWSKKMFC
IQNKFGPPHSIRKSKEDKKGAKFGHSMGLSQAPPPRSSARRSFGRSKRFSITRSLDDLES
ATVSDGELNSTELKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDSVGVK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSVSSEKSNMSTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLG
KSQKRRENGDYPNDSFQSNGLSYRRESQGSMSSTASLDLSETSRLPAFVPEKDKSPKYCC
VNLPDGSSSKMAVKSGFSIKEVLSGVCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESR
DLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLSGEQEPL
DLGVPISNLDGQRVVLEEKEPTKGRVTEERQRGVLVKQTATVSSSSRSQGSTGEGRTLGK
SNSIKMKGENGKNAREVRLSKREDSIAKIGKKKSQKINLDEAEEFFELISKAQSNRADDQ
RGLLRKEDLILPDFLRLPPAGPEPSSSTPTGPKGLSKRVSKSDGSDGCTSPSGKQESVQN
FNENSVKKMGYSENKHKSALAALHSQKTFSVPLSPPLSPIPHAQEGNAAVWKRQSRELQA
EGIQMVDDENVADLTLVAEGDISSPNSTLLPPPPSTP
Download sequence
Identical sequences H0ZJF0
59729.ENSTGUP00000010718 ENSTGUP00000010718 ENSTGUP00000010718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]