SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZL78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZL78
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily dUTPase-like 4.32e-17
Family dUTPase-like 0.00084
Further Details:      
 
Weak hits

Sequence:  H0ZL78
Domain Number - Region: 113-160
Classification Level Classification E-value
Superfamily Acid proteases 0.000368
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZL78
Sequence length 160
Comment (tr|H0ZL78|H0ZL78_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000011351} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SGSLSLDLATTIDINLIDMKPTRIPTMIKGPVMHREKPCGALLLGRSSAGLKGLSILPGV
IDADFTGEILIVAMTFYPPLIIPAGSKIAQLVPTLQLTEAASCIMHQLRGPDGFESTGGM
ALLCLPMEERPKAPVLLENGQQRLQLSTVLDTGADITIIS
Download sequence
Identical sequences H0ZL78
ENSTGUP00000011351 ENSTGUP00000011351 59729.ENSTGUP00000011351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]