SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0ZR52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZR52
Domain Number 1 Region: 618-873
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 7-266
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-54
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 316-550
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 921-1180
Classification Level Classification E-value
Superfamily YWTD domain 9.29e-40
Family YWTD domain 0.0000414
Further Details:      
 
Domain Number 5 Region: 875-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000102
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1233-1271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 573-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000247
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 1311-1349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000283
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1273-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 269-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000427
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1190-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZR52
Sequence length 1598
Comment (tr|H0ZR52|H0ZR52_TAEGU) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LRP6 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
VLCAAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVFLKGLIYWSDVSEEA
IKRTEFNKSGSIQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIELSNLDGSLRKVLFW
QELDQPRAIALDPARGFMYWTDWGEAPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQ
KLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYS
GEDLREIHSNIFSPMDIHAFSQRRQPNATNPCGTNNGGCSHLCLMSPTKPSYQCACPTGV
KLLENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYI
YWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNG
TMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNG
LALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRS
IERVHKCTAEREIIIDQLPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCAC
PIGLELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDN
RIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKL
DGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRAN
GLTIDYAKRRLYWTDLDTNLIESSSMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRS
IERANKTSGQNRTIIQAHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVC
GCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDP
LDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEA
TNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTERE
VLFFSGLSKPIALAVDGQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFE
NWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQDNGGC
SHICIVKGDGSTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFT
ECEDHSDEKNCPVCSDSQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCA
SGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFIC
QRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGG
SSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRS
YSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVPAAATKGYTSDLNYDSEPVPPPPTPRS
QYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences H0ZR52
ENSTGUP00000013094 ENSTGUP00000013094 59729.ENSTGUP00000013094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]