SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2J1C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2J1C7
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.97e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2J1C7
Sequence length 115
Comment (tr|H2J1C7|H2J1C7_RAHAC) Phosphotransferase system cellobiose-specific component IIA {ECO:0000313|EMBL:AEX54374.1} KW=Complete proteome; Reference proteome OX=745277 OS=105701 / NCIMB 13365 / CIP 78.65). GN=Rahaq2_4647 OC=Yersiniaceae; Rahnella.
Sequence
MMDLDSIVETESEMQDLEEVVMGLIINSGQARSLAYAALRKAKEGDFEQAYAVMAQSKMA
LNEAHLVQTKLIEDDQGEGKTKVSLVLVHAQDHLMTSMLARELIAELIELHEKIK
Download sequence
Identical sequences H2J1C7
gi|379704008|ref|YP_005220382.1| gi|379704008|ref|YP_005220382.1|NC_016835 WP_014341664.1.67156 WP_014341664.1.74596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]