SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JL25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JL25
Domain Number 1 Region: 200-350
Classification Level Classification E-value
Superfamily TPR-like 6.9e-23
Family BTAD-like 0.0024
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000177
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0066
Further Details:      
 
Domain Number 3 Region: 106-194
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000221
Family PhoB-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JL25
Sequence length 360
Comment (tr|H2JL25|H2JL25_STRHJ) Transcriptional regulator {ECO:0000313|EMBL:AEY93912.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_8647 OC=Streptomyces.
Sequence
MAMPTTTAGRCDRGVTGLTAEEREVLYALGCGLGNAEIAATLVLPEQVVAERLGRVLEKL
GLRDRAAAIVHAFDCGLVVPGQGPRRPEPGNSAARRTGTASGPWLSVSVLGPLRTTLAGR
PVDVGPVRQQAVLAALALSPRRSVSRRRLLEDVWGREMPDGNVVPVYVYRLRKSLRLGER
PDSVIRRDRYGYGLVQGIAEVDALCVDDLVTRAEEAERTGDLPGAVRLCAQALELFRGEP
LAGLPGPFAEAERVRLAQRRVGLAQRKADWQLRLGRRLEAITALSALALEEPLNEPVAAM
LMHALRRDGRRAEALAVFDRIARRLGDDLGVAPGDLLVRARRAALLGEDAGPGRGRAGAA
Download sequence
Identical sequences H2JL25
gi|386844727|ref|YP_006249785.1| gi|474986937|ref|YP_007697403.1| WP_014677193.1.21199 WP_014677193.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]