SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JRA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JRA2
Domain Number 1 Region: 50-183
Classification Level Classification E-value
Superfamily TPR-like 0.0000000293
Family CT2138-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2JRA2
Sequence length 237
Comment (tr|H2JRA2|H2JRA2_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY88514.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_3240 OC=Streptomyces.
Sequence
MQSLPKTLAEDVAKNLVMVARLIDEDPEGAYGYSKVALRLASRVAAVREAAGFAAYANQK
YGEALAEFRAARRMTGTVDLWPVMADCERGLGRPEKALDMAGAPEVHKLDKAGQVEMRLV
AAGARRDMGQLDAAIVTLQSPELASNSVQPWTARLRYAYADALLAAGREREAREWFAKAV
EADRDGSTDASDRLAELDGVEFVDALSEDVEDAEDAEDGADAAGESAEAAPEDGDKD
Download sequence
Identical sequences H2JRA2
WP_014671848.1.21199 WP_014671848.1.57224 gi|386839329|ref|YP_006244387.1| gi|474981539|ref|YP_007692005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]