SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JTM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JTM5
Domain Number 1 Region: 828-890
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.58e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0074
Further Details:      
 
Domain Number 2 Region: 3-52,90-207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000952
Family RecA protein-like (ATPase-domain) 0.061
Further Details:      
 
Domain Number 3 Region: 580-694,745-797
Classification Level Classification E-value
Superfamily TPR-like 0.0000185
Family Tetratricopeptide repeat (TPR) 0.063
Further Details:      
 
Weak hits

Sequence:  H2JTM5
Domain Number - Region: 479-565
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.0237
Family ROK 0.056
Further Details:      
 
Domain Number - Region: 347-424
Classification Level Classification E-value
Superfamily TPR-like 0.0331
Family Tetratricopeptide repeat (TPR) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JTM5
Sequence length 896
Comment (tr|H2JTM5|H2JTM5_STRHJ) LysR-family transcriptional regulator {ECO:0000313|EMBL:AEY86126.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_0849 OC=Streptomyces.
Sequence
MTALVDAAREGHGASALVHGEAGIGKSRLASAVVEAASSAGFAVLSCHGIRDAGAAGFEG
LHELLLPLLDRIDALPPRQRMALKVAFGAEGEPADRFITGLAAFGLLEEAAARGPLVLLV
EDLHWLDRSTADVVAFLAARMSVMPALLLATSRTDRVYPDRKLHFKHHVYVTPLGHEDAL
KLVALHAPALTLPQRRRLVERALGNPLALTEWSANPSWVEGPPSAHAGRVPMGRRLEDSF
LAEVALLPPATQQALLVAAAAEDASSYEVLAAARNLGLEQGDFAPAEKFGLLTLTRGTYK
FRHPLVGSAVYDNADFGARARVHTELAAVVVDAARAVQHRAAAVAGWDEDVAAELEALAV
TAGRRGARSEAAAAWRRAATLTPVAADRARRTVMAAEMARQAGATADAVALLTEARPIVE
DEASTVQFARTEWMLAGTSSTLLGRGGDELVAMSRRLSDPADRIEVLTWAAVRSYLRQDT
SLDLAAAVADELRRADAATGPQQVLRGIGLALVSPADRISSVEKALSFMQREAREAYATL
LNCLAFAVEDTHDLALAERVWGAGVDMFHQAARAGDVAVALSGRSTVRVTANTIAAGLTD
AELALRLSYDLDLPVVGALAAANIARARAWRGEHEPATAALNTCAELSGPTPAPRVAAVA
SWASAHVAANEGRADEAVAHLLACVEHPPIGVWAGGDIADTAVRAGRPELVGGWLDMATA
ALASGDSGHLAMLVERSRALLARGSEARGHFERAIERGEGTTAFLDLAKTRLFFGEWLRR
ERRIVEARSHLSAALHVFESHHAAPLVRRTARELGAAGSDVQRPQPGPALDAGTVLTAQE
LHVARLAAQGYTNRQIADQLYLSHRTVGAHLYKVYAKLQINRRSQLAAALASDTLD
Download sequence
Identical sequences H2JTM5
gi|474979216|ref|YP_007689682.1| gi|386836941|ref|YP_006241999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]