SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JW27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JW27
Domain Number 1 Region: 587-738
Classification Level Classification E-value
Superfamily TPR-like 0.0000000556
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 
Domain Number 2 Region: 710-821
Classification Level Classification E-value
Superfamily TPR-like 0.00000262
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JW27
Sequence length 1009
Comment (tr|H2JW27|H2JW27_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY91948.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_6681 OC=Streptomyces.
Sequence
MSEITDFDALRRALAENSEQPEGPARNARAEQLLAEAERLDIPLAVIEALGHQLKVYNYS
SEKDKMFVPFARLLRMWDERPEDFDAYETHSLYWVFKWMSAGMLDQPHIPLASVEKWLGE
MEHRYRLAGYSERAVRSAEFSVAAHIGDVARAERAYAAWLAADRDRMADCHACELRGQGA
WQARCGRDAEALRLWRPVLEGEFACAHEPHNVLASSLAPLLRLGRVEEARAHHLRGFRLV
RSMESMRGAYADHVEFCALTGNEARGLELLAERPAYFTDTGHPRSRLDFLAVVTLLMDRL
TELGHGGQRVPGPAGRTWTARELAAHARAEATELAERFDRRNGTSAVGDRVRARIAQRPL
VDRLPLGVRTVRPAPAVAPSPPAAPAEPDLPALLAEARRLSDTLRPQALDAWAAVARAAP
DGAGLTARDRAEIADHEAMARGPEGLELFERAAALYAEASDPGEALAARARGAYIRALTG
ELDTALTTVASLYDEALALYADEGTAVRQTASVAMSRARVLVRRVHETAGGGTGDGRGQE
FEEFTGAGSGEAAADTGQAVAEAEAAVREVLALVDGHGGGDVRLAARGAEAWAMLGELAG
VTGDAGRAAELFRRAAAAYVAAGLPWFALEYQVQVAALAHQTGDLAGAEAALRAALEHGA
PYVEPVGRAQLHLQLAEVLGGRDASGDAAEHALEAAHWADEAGESGTLGAWARHQLGGYL
LRRGRYAEAAEVLESALADLCADTHGDGTVVQARWWLGDCLGELGEHRAAAEQRLKAADL
ARHWPEQQDHATLAHLAAESLGSAGLTAEADRAYARAGELWRALGNTPFLVRSLRARAWL
ALDGEPGAADAHALMTQAVRECEAALAVAQEADREELATELGGTYRQFAELLARSVSEEA
EEAEESEEAEDPAVRAAFEAALEQMTRAVAVFATLGAAGLHLRTGAELAAGRLEADLGRP
ARAAARARGVLAAYEGAGETDETVLALREEAAYLLEAAQEQAKEDAERG
Download sequence
Identical sequences H2JW27
gi|386842763|ref|YP_006247821.1| WP_014675238.1.21199 WP_014675238.1.57224 gi|474984972|ref|YP_007695438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]