SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2K0Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2K0Y0
Domain Number 1 Region: 866-920
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.43e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0039
Further Details:      
 
Domain Number 2 Region: 14-91,133-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000132
Family Extended AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 3 Region: 611-748
Classification Level Classification E-value
Superfamily TPR-like 0.000000506
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 
Weak hits

Sequence:  H2K0Y0
Domain Number - Region: 729-834
Classification Level Classification E-value
Superfamily TPR-like 0.0872
Family Tetratricopeptide repeat (TPR) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2K0Y0
Sequence length 933
Comment (tr|H2K0Y0|H2K0Y0_STRHJ) LuxR-family transcriptional regulator {ECO:0000313|EMBL:AEY93409.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_8143 OC=Streptomyces.
Sequence
MSFDDLPLMGAVGPLVGRDRDLELVSGFLAHTGFSGALLLRGDPGVGKTVVLDALARSAA
DTGTCVLRIAGVQFEADVSYAALNQAFLPLRDVLDTLDGTHREALRVALGFGAGQPPERL
VVLNAALALLQAAATRSPVLIIVDDLPWVDRASAAVFGFVARRLSGTRIRFLAAMRPGAD
SFFESGGLPTYELPPLDTESATRLIDARFPHLARQVRRRVLHTAQGNPLALLELPRALRA
SQRAALETLPAVLPLGQRLQSLFMSRVRGLPTATRKLLLLAALEGSGEIGVLCGAAREWD
GSTGLEDLAPAEHDQLVRVDEDSRRLVFRHPLIRSAVVEAATSSSRRAAHRALAQVLSGR
PESRAWHLGEATIEPDEQVAARLEEAAHRILGRGDAVAAIAALTRAADLSPLGADRARRL
AEAAYIGAEATGALRSASELLENARRADPDHGRSLHSAAATVQLLLNGDGDVTTAHRLLV
GAIEEGTHGYDAGNAALIDALHLLSLLCIYGARAELWAPFHAALARLRPAPPALLSVLGQ
LYSDPARTGPATLRRFDRIIDGITDETDPARIVRVGTAAVYTDRLSALRAPSWRVVRQGR
NGGPVRRHLGVLLHLGLDGYHTGSWDEAIELADEGLALCTDSGYSFFSWYFHFSKGLVSA
SRGDIDTALMLADRMTDWASPRGLRSIVQYAHHVRVLTHGATGDFEAVFRHADAISPAGS
LEPYAQPSVWVFFDLVESALRTGRQAEARAHVRAVRASTVEALSPRLALLAGGAAGLVAE
DDEVAERFFNEALSAPGADEWPFDRARVQLARGERLRRAGAASEAEGPLRSAHGTFRRLG
ARPWTARAVQELRAVGSKVADTNDLRGTELTPREREIAELAASGLTNKQIAERFFISPRT
VGAHLYQIYPKLGVASRAALRDALTADPARHAP
Download sequence
Identical sequences H2K0Y0
gi|474986435|ref|YP_007696901.1| gi|386844224|ref|YP_006249282.1| WP_014676691.1.21199 WP_014676691.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]