SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2K4N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2K4N4
Domain Number 1 Region: 389-661
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.19e-26
Family Extended AAA-ATPase domain 0.082
Further Details:      
 
Domain Number 2 Region: 192-339
Classification Level Classification E-value
Superfamily TPR-like 4.93e-16
Family BTAD-like 0.0014
Further Details:      
 
Domain Number 3 Region: 96-188
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000128
Family PhoB-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2K4N4
Sequence length 766
Comment (tr|H2K4N4|H2K4N4_STRHJ) Regulator {ECO:0000313|EMBL:AEY85420.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_0139 OC=Streptomyces.
Sequence
MALNCATLSLISSTALSGTHGEYGFQGNRDSAGNARSTTGRTIHQSARLRVLYRPDTPVL
CRVQPTRSSPSHERALLMPRMEAALSRRGTEVSTSFSVLGPLRAWDGTVELSLGPPKQRG
LLALLLARAGQPVTTHEIVDVLWGQDPPDTAVNVIQRHVGALRRLLEPDLPAGISSRWLV
RGSGGYRLDVGVDNLDLLQFRSLRQDAEQEAQKGQSARAAGLLMRALELWRGPVATGIAP
VARAHPIFTTVDREQIAAVDRAAALAAQAGPALSQGILPVLHDTAALHPLDETLQARLVT
LLAITGRQAEAQKVYHSVRLRLAQDLGVEPGAELRAAWRMTSVATTDAVGYRGSTQAPSP
SASRIAAPPTQPTPQGASTVSRPNASITRPAQLPLSSAAFIGRKTELTFLEQLLSDKNGQ
AGPAVVSTIVGTAGVGKTALSVHFAHRAADLFPDGQLYADLRGFHPQTAMTTGETVQRFL
DALGVPANRIPSSLDGQTALYRSLLADRRLLIVLDNVSNSEHVRPLLPGFSPSLVIVTSR
NRLSGLVAETGAHCTTLGLLSTDDAHAFLSRRLGAKRVLREAGAANEIIKRCARLPLALA
IVSARAALNPSFSLTAIADELDDQWGCLDALTAEEPLIDTRSSFSWSYRKLSPDAARLFR
LLSLQPALGCTATTAATLAGLPVTHTKMLLSELNNNHILAEAAPGCYTSHELLRRYAKEL
CNLHTAPAEVRAARDRLLKLRQQNFATAPTRSSHGDGVGWRSADSA
Download sequence
Identical sequences H2K4N4
gi|386836235|ref|YP_006241293.1| WP_014668783.1.21199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]