SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2K5U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2K5U3
Domain Number 1 Region: 72-169
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000187
Family Tetratricopeptide repeat (TPR) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2K5U3
Sequence length 170
Comment (tr|H2K5U3|H2K5U3_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY91776.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_6509 OC=Streptomyces.
Sequence
MVPGGVLFVDLHGYDDAPVTADQALQSLLRALGAGPEHAWLDRERAGLVAAVHWAREGKH
VDTAMRLALCLSGYLRWRRHFDDAIGVGSAAQKAAHAIGNRRCQAMAWNNLGVALHESGR
VDEAIAAHLRNRDLCRDLGDRQGEAEAWHNLGNALAAKGQIDQAMEAYDP
Download sequence
Identical sequences H2K5U3
gi|474984800|ref|YP_007695266.1| gi|386842591|ref|YP_006247649.1| WP_014675069.1.21199 WP_014675069.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]