SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2L3K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L3K0
Domain Number 1 Region: 249-337
Classification Level Classification E-value
Superfamily TAFH domain-like 2.22e-34
Family TAFH domain-like 0.0000366
Further Details:      
 
Domain Number 2 Region: 643-691
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000377
Family TBP-associated factors, TAFs 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2L3K0
Sequence length 853
Comment (tr|H2L3K0|H2L3K0_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000000324} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
PKGAPGPAASSSASQVVNHSIPLMQPKVPPPAAAVQPEVSQPPGVKPAVNGLVQPAAATP
ARTPLPGGPTSIQQQKPALMAGVTRPVAPQLAVRPQQQQATIQLPSGFTIPPGMVLVRTE
TGQLVLVPQQVLAQAQVCGNFTSRGAILEFPEWIELCSYFNNSHSSGITRKCFVILIKKK
MAQSPSTTTVQGLTVAPGSSVVSVKMPTAQKTQTGMVAGGVTPVEPPVTAGAPPASAPTA
SRVTVLSQQEMQENVKKCKNFLATLIKLASHNSPSPETAKNVKALVQDLLDAKIEPEEFT
SRLQADLKSSPQPYLIPFLKKSLPALRQTLFSSQQFLTTAPPVTPAPAPAAPGSIAATAI
RPRLPTAATGGAVRLNPPMTNTTALPPIIQVFPLKNYNPISWTFSASIFTVFPKGPPPAA
ARPGAQVLQTRSPVVIGHQECVLADQNQQPLAAVFAVTLLRGPLCTAGKSPVSLAASANQ
KKQCDPGGGTFSLYFVGTRLETQIDTRFAPSTGAKGTLRRALFSRRCCILPVCFFNQPCY
SHNAAATQAEGELFVFTPPCTAPPCSFLNTYNSMATRALAPPLAPKTHVGLQPSTTAAFR
DDDDINDVASMAGVNLNEENARILATSSEIVGTKIRSCKDEFFLPADVLHRRILDTARKL
GVTEVPADVVNVVSHATQFRLRSLLEKVSVVAQHRADAVKDEDLYEQTSDVRAQLRFFEQ
LERIEKQRKDEQEREMLLKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTAL
AAIGPRKKRKLDSVGGANTGSEVSSGLGSLGSPSPRQQLRQRITRVNLRDFILCLEQDRS
TARSMALYKALLK
Download sequence
Identical sequences H2L3K0
ENSORLP00000000324 8090.ENSORLP00000000324 ENSORLP00000000324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]