SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2LZW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LZW5
Domain Number 1 Region: 242-371,407-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.83e-37
Family Hemopexin-like domain 0.00095
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000536
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000484
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2LZW5
Sequence length 473
Comment (tr|H2LZW5|H2LZW5_ORYLA) Proteoglycan 4b {ECO:0000313|Ensembl:ENSORLP00000011688} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MTALKLPCAVMLLVCALKFSATQTSCKGRCGAEYYRGYMCQCDYGCLLYEECCTDYESQC
TTQNSCKGRCGETFKRGRLCTCDSDCIKFKQCCPDYKTQCESEVFFSEGSSTPVTDPLQW
DLLGLALCLVQSQNSTFHHFGDSINALSWYTESVKPFEFADIEAEVPVATTVPDSTSGDG
SSPSDLLDQVPTDPTVDGDVSLTQMTVSVSGDPLTSSQAPGDQEQELDQKRTFSTDDSND
KNLCSGRPISGVTTLRNGTIAVFRGHYFWFLDRNRVPSPPQSITQVWGVPSPIDTVFTRC
NCEGKTYIFKGSRYWRYDNDVLEPGYPKVIKTGFDGLRGHITAALSVPQYRSRREAVFFF
KRGGFVQKYSYQAGTSRTCGRKVGNPIVTVRYRSARQAATILEPAINIRKSWKGFPFQIT
AAVSVPSTQEQEGYKYFVFSRSSTYNVRISGERPTIAAKENATPQSNSFFTCP
Download sequence
Identical sequences H2LZW5
8090.ENSORLP00000011688 ENSORLP00000011688 ENSORLP00000011688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]