SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2MHR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MHR4
Domain Number 1 Region: 761-907
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-37
Family Regulator of G-protein signaling, RGS 0.0000884
Further Details:      
 
Domain Number 2 Region: 1094-1189
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-27
Family Ras-binding domain, RBD 0.00097
Further Details:      
 
Domain Number 3 Region: 2-81
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-20
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 249-368
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-19
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 5 Region: 1040-1108
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000031
Family First domain of FERM 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MHR4
Sequence length 1577
Comment (tr|H2MHR4|H2MHR4_ORYLA) Regulator of G protein signaling 12b {ECO:0000313|Ensembl:ENSORLP00000018182} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
RIHTVEVARGRTGYGFTLTGQSPCVLSCILKGSPADYVGLHSGDYILAVNDINVSKASHE
DVVKLIGRCSGVLKLVISEGDCNWRHHRPSYLDSCSSDDELDAFYEYSSHSRSGGGARAA
RGKAPMDSKQLGINRAEKVVAELQSGGIFNMIFENSSHSSSSSDKDRPGVGCKSNPRRLS
EPEFPPFHSRCQSNPNLLSKEEMAHVLNDDSVFLESDVRHLHLQNHDEGDVDVEGGAFGL
EPCEDIVNVGMIAGYLGSIELASTGANLESDSLQAIRGSMRRLRAEQKIHSLVLMKVMHD
SVCLCSDRGQVLATYPAEKLAFSACCPDDRRFFGLVTMQATDDSGHYSHGGDEEGGLRTS
CHVFIVDPELCLHQVHVGVARRFGFECTPDPDTGGCLEFPPSSQPLLQFISVLYRDMGDS
IEGVRARAFQDADNDAQQNHSTSSNSDSGIGNFQPEEKSNRVLLVDLGGPHSHSHVPGMR
HWNSPPSSQHVWGPALGAAASLPPPPPPPLLRNGHYLHDPHLADLPHPLPLAHPDVPGRQ
LRGIHPHHYSGKLGGAAGGGDRRGGGGASGQDPQRWLPVHVLRDWRQQHGHLPGPSSDQE
SYAESTDGWSSANCSTLPPPMSKIPADRYRAPLAPGDHLQPPGGQHPPHPPHPHHQRPVA
QKDEWAKKLFGGGDRERSRGRRGDREKKRSSKEGDKKAGRFRGLTMGFPPLQQRSSTRRS
FGRSKRLSVARSLDDLESAAVSDGELNSAELQGCSSDSLNSNASLPSVQSHRRHTERRVA
SWAVCFERLLQDPVGIRYFSEFLKKEFSEENILFWQACEFFSHLPENDAKQLTQRAREIY
NSFLSSKATTPVNIDSQAQLADDILNAPKPDMFKEQQLQIFNLMKFDSYTRFLKSLLYQE
CMVAEVEGRPLPDPYHVPSSPTSKHSTTGSDRSNLSTPKKVEHGPESKSGRSLNEDSRED
SGDRRRGMFFSWSRNRSFGKGPKKRELADFNYNFPGSNGRRESQGSLSSGASLELGTSAS
GKNEGGGTSEQGGSSAPLRQCSISLPDGSCCSVPLRAGVSIRDLLQGLCEKLCISLAAVD
LFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPV
VAKYGLHLSGLVARISGESEPLDLGLPISNLDGLRVVLDVAENAVGKGETAQLQKAVSPR
SLLPASAGRNQSAPVVPDSLEEKAEDEKSRVAPEKRKQKKINIDEAEEFFDLISKAQSNR
NDDQRGLLNKSHLQLPDFLRLSPAPPDFGSSTPNSRNPQNGGFPGNGRRGNKPNGGGERG
LLGGAHLLSASHHSQSLDSGIGPDRDRKTRPPPSFPTTVSPIRPTQPTRHQDTNQMPEED
AMSDLTLVGEGDINSPNLHYITPSALPCTSRPSDRQPSSGHSWAKAGDTLDRSPVSSSSS
GKDGAGWRGRDKGGGGFKTPGRRPSNPVPWSPPPPPPRPPLRSRRKSKSPSSRPGHSTPK
QALDLDRLGGGPDPGDDGQPRSGRRDLRGGLQSRGSRMRSAVYQTSDLPSMVKARRELDP
REGRAQTARSKLKATFV
Download sequence
Identical sequences H2MHR4
ENSORLP00000018182 8090.ENSORLP00000018182 ENSORLP00000018182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]