SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2N9W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2N9W2
Domain Number 1 Region: 349-489
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-41
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 2 Region: 930-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-40
Family C-type lectin domain 0.00049
Further Details:      
 
Domain Number 3 Region: 644-778
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-38
Family C-type lectin domain 0.000000106
Further Details:      
 
Domain Number 4 Region: 788-924
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-37
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 5 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-36
Family C-type lectin domain 0.00018
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.53e-35
Family Cysteine rich domain 0.000000903
Further Details:      
 
Domain Number 7 Region: 499-637
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 165-342
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-29
Family C-type lectin domain 0.00091
Further Details:      
 
Domain Number 9 Region: 1090-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-28
Family C-type lectin domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2N9W2
Sequence length 1455
Comment (tr|H2N9W2|H2N9W2_PONAB) Mannose receptor C-type 1 {ECO:0000313|Ensembl:ENSPPYP00000002469} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=MRC1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MRLPLLLVFASVIPGAVLLLDTRQFLIYNEDHKRCVDAISPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGISLWSRWKIYGTTDNLCSRGYEAMYTLLGNANGATCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDTDKLFGYCPLKFEGSESLWNKDPLTSISYQINSKSALTW
HQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAWENLECVQKLGYVCKKGNTTLNSFVIPSESDVPTH
CPSQWWPYAGHCYKIHRDEKKIQRDALTACRKEGGDLASIHTIEEFDFIISQLGYEPNDE
LWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRGCEWP
LGYICKMKSQSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTT
IEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCV
AMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFK
LYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHELFWLGLTYGS
PSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQK
GQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRSFGDLVSIQSE
SEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT
MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTTPSVPSGCKEGWNFYNNKCFKIFG
FMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFSAWTGLNDVNSEHTFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGTSNEAGKWMDDTCDSKRGYICQT
RSDPSLTNPPATIQTDGFIKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAF
AWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYWKT
AHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASL
ECLRMGSSLVSIESAAEFSFLSYRVEPLKSKTNFWIGLFRNVEGTWLWINNSPVSFVNWN
TGDPSGERNDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAEPTQELLTTKADTRKMDP
SKPSSNVAGVVIIVILLILTGAGLAAYFFYKKRRVHLPQEGAFENTLYFNSQSSPGTSDM
KDLVGNIEQNEHAVI
Download sequence
Identical sequences H2N9W2
ENSPPYP00000002469 9600.ENSPPYP00000002469 ENSPPYP00000002469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]