SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2NAZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NAZ6
Domain Number 1 Region: 21-229
Classification Level Classification E-value
Superfamily PHP domain-like 1.22e-45
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NAZ6
Sequence length 267
Comment (tr|H2NAZ6|H2NAZ6_PONAB) Ribonuclease P/MRP subunit p30 {ECO:0000313|Ensembl:ENSPPYP00000002866} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0037932 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAVFADLDLRAGSDLKVLRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTT
LPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISNALNLMQIC
KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG
IISTVKKPRPSEDEDCLPASKKAKCEG
Download sequence
Identical sequences H2NAZ6
ENSPPYP00000002866 9600.ENSPPYP00000002867 ENSPPYP00000002866 XP_009243892.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]