SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2NBU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NBU0
Domain Number 1 Region: 62-108,148-204
Classification Level Classification E-value
Superfamily POZ domain 0.00000126
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NBU0
Sequence length 505
Comment (tr|H2NBU0|H2NBU0_PONAB) BTB domain containing 16 {ECO:0000313|Ensembl:ENSPPYP00000003170} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=BTBD16 OC=Catarrhini; Hominidae; Pongo.
Sequence
MIMSNTHKARLERRVAGSTNRWRLPKQPFSGDLLSLSQMCKALSIDFEEALRNPDRLCMS
QIQKFFCENFKKKDIQSGEADVILECLGFKWELHQPQVFQSETLAKLYFKALAQGTTHPL
RELEELLRAQSPKKTKEKSPAKRIIISLKINDPLVTKVAFATALKNLYMSEVEINLEDVL
GVLASAHILQFRGLFQRCVDVMIARLMPSTIKKFYEAGCKYKEEQLTTGCEKWLEMNLVP
LVGMQIHLHKIPQDLLHKVLKSPRLFTFSEFHLLKTMLLWVFLQLNHKIQAIPTYETVMT
FFKSFPENCCFLDRDIGQSLRPLFLCLRLHGITKGKDLEVLRHINFFPESWLDQVTANHY
HALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFKIKGLKHDTTSYSFYMQ
RIKHTDLESSSAVYEHNPVSLRVARLVKYEIRAEALVDGKWQEFRTNQIKQKFGLTTSSC
KSHTLKIQTVGIPIYVSFAFIFPAS
Download sequence
Identical sequences H2NBU0
9600.ENSPPYP00000003170 ENSPPYP00000003170 ENSPPYP00000003170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]