SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2NFC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NFC0
Domain Number 1 Region: 206-453
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-88
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-17
Family Hepsin, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NFC0
Sequence length 458
Comment (tr|H2NFC0|H2NFC0_PONAB) Transmembrane protease, serine 5 {ECO:0000313|Ensembl:ENSPPYP00000004453} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=TMPRSS5 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSLMLHDQPPVEAQYAEEGPGPGIFREEPGDQQHPISQAVCWRSRRRGCAVLGALGLLAG
AGVGSWLLVLYLCPAASQPISGTLQDEEITLSCSEASGEEALLPALPKTVSFRINSEDFL
LEVQVRDRPGWLLVCHEGWSPTLGLQICWSLGHLRLTHHKGVNLTDIKLSRSQEFAQLSP
RLGGFLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFR
HTCGGSVLAPHWVVTAAHCMHSFRMARLSSWRVHAGQVSHSAVRPHQGAVVERIIPHPLY
SAQNHDYDVALLRLRTPLSFSDTVGAVCLPAKEQHFPKGSQCWVSGWGHTDPGHTYSSDM
LQDTVVPLLSTQLCNSSCVYSGALTHRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLV
GVVSWGRGCAEPNHPGVYAKVAEFLDWIHDTAQVSLTL
Download sequence
Identical sequences H2NFC0
ENSPPYP00000004453 ENSPPYP00000004453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]