SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2NS55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NS55
Domain Number 1 Region: 244-307
Classification Level Classification E-value
Superfamily RILP dimerisation region 2.09e-17
Family RILP dimerisation region 0.0000296
Further Details:      
 
Weak hits

Sequence:  H2NS55
Domain Number - Region: 80-125
Classification Level Classification E-value
Superfamily BLRF2-like 0.0458
Family BLRF2-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NS55
Sequence length 400
Comment (tr|H2NS55|H2NS55_PONAB) Rab interacting lysosomal protein {ECO:0000313|Ensembl:ENSPPYP00000008762} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=RILP OC=Catarrhini; Hominidae; Pongo.
Sequence
MEPRRAAPGAPGWGSREAAGSGMAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVR
ALELLEQAAVGPAPESLQVSAQQAEQELRRLREENERLRRDLRAGPQEERALLRQLKEVT
DRQRDELRAHNRDLRQRGQESEALQEQLQRLLLVNAELRHKLAAVQTQLRAAQDRERERQ
QPGEAATPQAKERAREQAGRPGHQHGQEPEWATAGAGAPGNPEDSVEAAQQLGCPSEAGQ
CRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKK
IKAKMLGTPEEAESSGDEDGSWLLLSDDKGDHPPTPESKIQSFFGLWYRGKAESSEDETS
SPAPSKLGGEEAQPQSPAPDPPCSALHEHLFLGASAAPEA
Download sequence
Identical sequences H2NS55
9600.ENSPPYP00000008762 ENSPPYP00000008762 ENSPPYP00000008762 XP_002826855.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]