SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NSQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NSQ6
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily EF-hand 1.26e-44
Family Calmodulin-like 0.0000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NSQ6
Sequence length 200
Comment (tr|H2NSQ6|H2NSQ6_PONAB) Recoverin {ECO:0000313|Ensembl:ENSPPYP00000008969} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0035343 OC=Catarrhini; Hominidae; Pongo.
Sequence
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKMKNA
Download sequence
Identical sequences G3QZN4 H2NSQ6 H2QC95 P35243
ENSP00000226193 gi|4506459|ref|NP_002894.1| ENSP00000226193 9598.ENSPTRP00000014928 9600.ENSPPYP00000008969 9606.ENSP00000226193 ENSPTRP00000014928 ENSPPYP00000008969 ENSGGOP00000008349 ENSGGOP00000008349 ENSPTRP00000014928 NP_002894.1.87134 NP_002894.1.92137 XP_002827073.1.23681 XP_003818145.1.60992 XP_004058625.1.27298 XP_009431030.1.37143 ENSP00000226193 ENSPPYP00000008969 hsi002004436.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]