SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2NVB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NVB9
Domain Number 1 Region: 4-434
Classification Level Classification E-value
Superfamily ALDH-like 1.13e-134
Family ALDH-like 0.00000000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NVB9
Sequence length 453
Comment (tr|H2NVB9|H2NVB9_PONAB) Aldehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR036492} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0051956 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALRRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYMLCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPLLPIVCVRSLEEAIQFINQREK
PLALYVFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEALKVRYPPSPAKMTWH
Download sequence
Identical sequences H2NVB9
ENSPPYP00000009919 ENSPPYP00000009919 9600.ENSPPYP00000009919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]