SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2NWR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NWR7
Domain Number 1 Region: 16-252
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.28e-74
Family Eukaryotic proteases 0.00000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NWR7
Sequence length 253
Comment (tr|H2NWR7|H2NWR7_PONAB) Complement factor D {ECO:0000313|Ensembl:ENSPPYP00000010432} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CFD OC=Catarrhini; Hominidae; Pongo.
Sequence
MHSWERLAVLVLLGAAACAAQPRGRILGGREAEAHARPYMASVQVNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLIQL
SEKATLGPAVRPLPWQRVDHDVAPGTLCDVAGWGIVNHAGRRPDRLQHVLLPVLDRATCN
RRTHHDGAITERMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWLDSVLA
Download sequence
Identical sequences H2NWR7
9600.ENSPPYP00000010432 ENSPPYP00000010432 ENSPPYP00000010432 XP_003779057.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]