SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NZU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NZU0
Domain Number 1 Region: 16-204
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.1e-59
Family Eukaryotic proteases 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NZU0
Sequence length 207
Comment (tr|H2NZU0|H2NZU0_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000011533} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MWVLVLFIALPVGCTNSQVWLGRHNLFEPEDTGQRVPVSHSFPYPLYNMSLLKRRSLRPD
EDSSHDLMLLRLSEPAKITDAVKVLGLPTQEPALGTTCYASGWGSIQPEEFLRPKSLQCV
SLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPC
ALPEKPAVYTKVVHYQKWIKDTISANP
Download sequence
Identical sequences H2NZU0
9600.ENSPPYP00000011533 ENSPPYP00000011533 ENSPPYP00000011533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]