SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2P3M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P3M9
Domain Number 1 Region: 37-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.12e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000104
Further Details:      
 
Domain Number 2 Region: 392-520
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.25e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2P3M9
Sequence length 522
Comment (tr|H2P3M9|H2P3M9_PONAB) Thioredoxin reductase 2 {ECO:0000313|Ensembl:ENSPPYP00000012925} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0052100 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPHYGWEVAQP
VLHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSLVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDRA
TGKEDMGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDV
VEGRPELTPTAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLLLGLHFLGPNAGEVTQGFALG
IKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGC
Download sequence
Identical sequences H2P3M9
ENSPPYP00000012925 9600.ENSPPYP00000012925 ENSPPYP00000012925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]