SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2P6Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P6Y6
Domain Number 1 Region: 178-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-58
Family Voltage-gated potassium channels 0.00077
Further Details:      
 
Domain Number 2 Region: 25-139
Classification Level Classification E-value
Superfamily POZ domain 2.09e-23
Family Tetramerization domain of potassium channels 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2P6Y6
Sequence length 494
Comment (tr|H2P6Y6|H2P6Y6_PONAB) Potassium voltage-gated channel modifier subfamily F member 1 {ECO:0000313|Ensembl:ENSPPYP00000014122} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0022599 OC=Catarrhini; Hominidae; Pongo.
Sequence
MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGY
DTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDL
KFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCP
ARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLR
LFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI
FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQS
FWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE
TAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLL
TEEKHHRTRLQSCK
Download sequence
Identical sequences A0A0D9S9T6 A0A2J8NLW0 G7NBA5 H2P6Y6 Q9H3M0
ENSMMUP00000003775 ENSP00000295082 ENSPPYP00000014122 ENSNLEP00000023186 ENSP00000295082 9544.ENSMMUP00000003775 9600.ENSPPYP00000014122 9606.ENSP00000295082 NP_001244508.1.72884 NP_002227.2.87134 NP_002227.2.92137 XP_003272793.1.23891 XP_004028894.1.27298 XP_007969669.1.81039 XP_010377971.1.97406 XP_011747678.1.29376 XP_011816294.1.43180 XP_011900015.1.92194 XP_016802643.1.37143 ENSPPYP00000014122 ENSNLEP00000023186 ENSGGOP00000009305 ENSMMUP00000003775 ENSP00000295082 gi|20070166|ref|NP_002227.2| ENSGGOP00000009305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]