SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2P7M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P7M5
Domain Number 1 Region: 56-299
Classification Level Classification E-value
Superfamily vWA-like 2.22e-78
Family Integrin A (or I) domain 0.0000000698
Further Details:      
 
Domain Number 2 Region: 297-384
Classification Level Classification E-value
Superfamily Integrin domains 3.03e-23
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 548-631
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.15e-19
Family Integrin beta tail domain 0.00096
Further Details:      
 
Domain Number 4 Region: 506-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 5 Region: 464-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  H2P7M5
Domain Number - Region: 431-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2P7M5
Sequence length 714
Comment (tr|H2P7M5|H2P7M5_PONAB) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ITGB6 OC=Catarrhini; Hominidae; Pongo.
Sequence
MITYKVAVPWEVQKPVKTACLLDLSVPGVLRRILPVHLELAKGGAQTLQVHVRQTEDYPV
DLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEI
ANPCSSIPYFCLPTFGFKHIPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKE
KIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLVEYPTIG
QIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSE
VELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFNVTVNIPNCERRSRHII
IKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGE
DILSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCMRHKGLLCGG
NGDCDCGECVCRSGWTGEYCNCTTSTDSCISEDGVLCSGRGDCVCGKCVCTNPGASGPTC
ERCPTCGDPCNSKRSCIECHLSAAGQAQEECVDKCKLAGATISEEEDFSKDGSVSCSLQG
ENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLV
SFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
Download sequence
Identical sequences H2P7M5
ENSPPYP00000014370 ENSPPYP00000014370 9600.ENSPPYP00000014370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]