SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2P9R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P9R8
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.19e-45
Family Calponin-homology domain, CH-domain 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2P9R8
Sequence length 199
Comment (tr|H2P9R8|H2P9R8_PONAB) Transgelin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0013818 OC=Catarrhini; Hominidae; Pongo.
Sequence
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM
Download sequence
Identical sequences A0A0D9R2M8 A0A2I3GDA0 A0A2I3N481 A0A2K5M0B9 A0A2K5S296 A0A2K5XCH3 A0A2K6EAT2 A0A2K6U5H5 D2H6H8 G3RJS5 G7MK53 G8F2A6 H2P9R8 H2QN35 Q4R5J4 Q9UI15 U3CP74
GO.35279 ENSPTRP00000026243 ENSP00000273368 ENSP00000377494 ENSP00000391160 ENSP00000419105 9544.ENSMMUP00000000939 9598.ENSPTRP00000026243 9600.ENSPPYP00000015157 9606.ENSP00000273368 gi|56549135|ref|NP_037391.2| gi|56549137|ref|NP_001008273.1| gi|56549139|ref|NP_001008274.1| ENSPTRP00000026243 ENSMMUP00000000939 ENSPPYP00000015157 ENSPPYP00000015157 ENSP00000273368 ENSP00000377494 ENSP00000391160 ENSP00000419105 ENSMMUP00000000939 ENSNLEP00000005060 NP_001008273.1.87134 NP_001008273.1.92137 NP_001008274.1.87134 NP_001008274.1.92137 NP_001253833.1.72884 NP_037391.2.87134 NP_037391.2.92137 XP_002917360.3.58354 XP_003935521.1.74449 XP_004036094.1.27298 XP_005548241.2.63531 XP_007984033.1.81039 XP_010344303.1.74449 XP_011825112.1.47321 XP_011825113.1.47321 XP_011825114.1.47321 XP_011938437.1.92194 XP_011938438.1.92194 XP_014199836.1.60992 XP_014985284.1.72884 XP_016797121.1.37143 XP_017403316.1.71028 XP_017403317.1.71028 XP_017403318.1.71028 XP_017820745.1.60252 XP_018879861.1.27298 ENSGGOP00000015971 ENSPANP00000018593 ENSGGOP00000015971 ENSP00000273368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]