SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2PN16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PN16
Domain Number 1 Region: 495-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.68e-60
Family Eukaryotic proteases 0.00000000249
Further Details:      
 
Domain Number 2 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-36
Family Kringle modules 0.00000541
Further Details:      
 
Domain Number 3 Region: 210-293
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-34
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 4 Region: 302-386
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-31
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 381-477
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.35e-23
Family Hairpin loop containing domain 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PN16
Sequence length 728
Comment (tr|H2PN16|H2PN16_PONAB) Scatter factor {ECO:0000256|PIRNR:PIRNR001152} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0018154 OC=Catarrhini; Hominidae; Pongo.
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKYLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHHMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
Download sequence
Identical sequences H2PN16
ENSPPYP00000020015 9600.ENSPPYP00000020015 ENSPPYP00000020015 XP_002818342.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]