SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2PST4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PST4
Domain Number 1 Region: 45-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.12e-55
Family Dual specificity phosphatase-like 0.0000000384
Further Details:      
 
Domain Number 2 Region: 199-375
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-48
Family Dual specificity phosphatase-like 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PST4
Sequence length 498
Comment (tr|H2PST4|H2PST4_PONAB) Cell division cycle 14B {ECO:0000313|Ensembl:ENSPPYP00000021757} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0008814 OC=Catarrhini; Hominidae; Pongo.
Sequence
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAI
LYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVH
FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLL
DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY
HQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFL
VMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSAS
RKSSVKSLSISRTKTVLR
Download sequence
Identical sequences H2PST4 H2R3T7 O60729
ENSPPYP00000021757 ENSP00000364389 ENSP00000364389 ENSPTRP00000046055 9598.ENSPTRP00000046055 9600.ENSPPYP00000021757 9606.ENSP00000364389 NP_201588.1.87134 NP_201588.1.92137 XP_002820045.1.23681 XP_009455213.1.37143 gi|15451936|ref|NP_201588.1| ENSPPYP00000021757 HR4745 O60729 ENSPTRP00000046055 ENSP00000364388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]