SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2PW04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PW04
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily FKBP-like 4.25e-29
Family FKBP immunophilin/proline isomerase 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PW04
Sequence length 131
Comment (tr|H2PW04|H2PW04_PONAB) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363014} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=PIN4 OC=Catarrhini; Hominidae; Pongo.
Sequence
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
Download sequence
Identical sequences H2PW04 Q9Y237
ENSPPYP00000022907 XP_002813636.2.23681 XP_002831846.1.23681 XP_003280920.1.23891 XP_010330700.1.74449 XP_012291037.1.9421 ENSPPYP00000022907 ENSNLEP00000022013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]