SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PXZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PXZ6
Domain Number 1 Region: 6-88
Classification Level Classification E-value
Superfamily Histone-fold 6.98e-16
Family TBP-associated factors, TAFs 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PXZ6
Sequence length 138
Comment (tr|H2PXZ6|H2PXZ6_PANTR) CENPS isoform 1 {ECO:0000313|EMBL:PNI39763.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0034998 OC=Catarrhini; Hominidae; Pan.
Sequence
MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCEN
FAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSGD
GSKNSKQPAEAGVVESEN
Download sequence
Identical sequences H2PXZ6
NP_001191821.1.37143 XP_003822141.1.60992 XP_003822142.1.60992 XP_008973871.1.60992 ENSPTRP00000000256 ENSPTRP00000000256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]