SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2PYY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PYY6
Domain Number 1 Region: 457-532,599-781
Classification Level Classification E-value
Superfamily RNI-like 3.53e-25
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PYY6
Sequence length 812
Comment (tr|H2PYY6|H2PYY6_PANTR) Leucine rich repeat containing 41 {ECO:0000313|EMBL:JAA10784.1, ECO:0000313|Ensembl:ENSPTRP00000001199} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0025658 OC=Catarrhini; Hominidae; Pan.
Sequence
MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPNAPPALFELCGRAVSAHMGV
LESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLES
VTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELV
AEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPES
ALFILILTMSAGFWQPGPGGPPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAA
LMASRRKSEAKQMPRAAPATRVTRRSTQESLTAGGTDLKRELHPPATSHEAPGTKRSPSA
PAATSSASSSTSSYKRAPASSAPQPKPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIV
AGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAALTL
CHLLSSWVSLESLTLSYNGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPILELT
RAIVRALPLLRVLSIRVDHPSQRDNPGVPGNAGPPSHIIGDEEIPENCLEQLEMGFPRGA
QPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEYNLALKRLSFHDMNLADCQ
SEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKGNSTLKGLRLPGNRLGNAGLL
ALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQDAVT
AREAIRRLRATCHVVSDSWDSSQAFADYVSTM
Download sequence
Identical sequences G3SCF0 H2PYY6 Q15345
ENSGGOP00000025778 9606.ENSP00000343298 ENSPTRP00000001199 ENSP00000343298 ENSP00000477792 NP_006360.3.87134 NP_006360.3.92137 XP_004025768.1.27298 XP_513144.3.37143 ENSPTRP00000001199 ENSP00000343298 gi|38569471|ref|NP_006360.3| ENSP00000343298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]