SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2PZ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PZ68
Domain Number 1 Region: 795-970
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.59e-48
Family Chaperone J-domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 120-276
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.09e-27
Family Dual specificity phosphatase-like 0.00028
Further Details:      
 
Domain Number 3 Region: 284-421
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-26
Family PLC-like (P variant) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PZ68
Sequence length 970
Comment (tr|H2PZ68|H2PZ68_PANTR) DnaJ heat shock protein family (Hsp40) member C6 {ECO:0000313|Ensembl:ENSPTRP00000001430} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0010381 OC=Catarrhini; Hominidae; Pan.
Sequence
MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRAST
MDSSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGD
LDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHS
RVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCN
LYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPIPF
FNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSMYHL
RSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDV
ELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQS
GFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNTNSDKPHGVKKPSK
KQQEPAAPPPPEDVDLLGLEGSAVSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSG
VEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTS
SASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSS
HGTPTHQNKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQ
QGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAADFE
DLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTV
LWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSE
FENQGQKPLY
Download sequence
Identical sequences H2PZ68
ENSPTRP00000001430 ENSPTRP00000001430 9598.ENSPTRP00000018764 XP_001161657.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]